Lineage for d4tuob1 (4tuo B:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744204Domain d4tuob1: 4tuo B:1-113 [274925]
    Other proteins in same PDB: d4tuob2, d4tuod2
    automated match to d1t66c1
    complexed with na

Details for d4tuob1

PDB Entry: 4tuo (more details), 1.55 Å

PDB Description: crystal structure of monoclonal antibody against neuroblastoma associated antigen.
PDB Compounds: (B:) Light chain of monoclonal antibody against neuroblastoma associated antigen

SCOPe Domain Sequences for d4tuob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tuob1 b.1.1.1 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelk

SCOPe Domain Coordinates for d4tuob1:

Click to download the PDB-style file with coordinates for d4tuob1.
(The format of our PDB-style files is described here.)

Timeline for d4tuob1: