SCOPe 2.06: Domain d4s3od1: 4s3o D:2-147

Lineage for d4s3od1 (4s3o D:2-147)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)

8. Domain d4s3od1: 4s3o D:2-147 [274920]
   Other proteins in same PDB: d4s3oa2, d4s3od2
   automated match to d3rpga_
   complexed with zn

Details for d4s3od1

PDB Entry: 4s3o, 2 Å

PDB Description: pcgf5-ring1b-ubch5c complex

PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d4s3od1:

Sequence; same for both SEQRES and ATOM records:

>d4s3od1 d.20.1.1 (D:2-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

Timeline for d4s3od1:

• d4s3od1 first appeared in SCOPe 2.05, called d4s3od_
  
• d4s3od1 appears in SCOPe 2.07
  
• d4s3od1 appears in the current release, SCOPe 2.08