SCOPe 2.07: Domain d4rfel1: 4rfe L:3-107

Lineage for d4rfel1 (4rfe L:3-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (33 PDB entries)

8. Domain d4rfel1: 4rfe L:3-107 [274917]
   Other proteins in same PDB: d4rfeb2, d4rfed2, d4rfef2, d4rfel2
   automated match to d2mcg11
   complexed with cl, gol, so4

Details for d4rfel1

PDB Entry: 4rfe, 1.91 Å

PDB Description: crystal structure of adcc-potent anti-hiv-1 rhesus macaque antibody jr4 fab

PDB Compounds: (L:) Fab light chain of ADCC-potent anti-HIV-1 antibody JR4

SCOPe Domain Sequences for d4rfel1:

Sequence; same for both SEQRES and ATOM records:

>d4rfel1 b.1.1.0 (L:3-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vltqppsvsaapgqkvtiscsgsssnigrsyvswyqqvpgaapklliydtnkrpsgvsdr
fsgsksgssaslaitglqtgdeadyycgawdgslnvhifgsgtkltvlg

Timeline for d4rfel1:

• d4rfel1 first appeared in SCOPe 2.05
  
• d4rfel1 appears in SCOPe 2.06
  
• d4rfel1 appears in the current release, SCOPe 2.08