Lineage for d4rb1a_ (4rb1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984416Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries)
  8. 1984425Domain d4rb1a_: 4rb1 A: [274910]
    Other proteins in same PDB: d4rb1b2
    automated match to d4etsa_
    protein/DNA complex; complexed with mn

Details for d4rb1a_

PDB Entry: 4rb1 (more details), 2.75 Å

PDB Description: crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+- e. coli fur box
PDB Compounds: (A:) DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)

SCOPe Domain Sequences for d4rb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rb1a_ a.4.5.0 (A:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
vsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvrl
feeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgfr
lvghrlelygvp

SCOPe Domain Coordinates for d4rb1a_:

Click to download the PDB-style file with coordinates for d4rb1a_.
(The format of our PDB-style files is described here.)

Timeline for d4rb1a_: