Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries) |
Domain d4rb1b_: 4rb1 B: [274909] automated match to d4etsa_ protein/DNA complex; complexed with mn |
PDB Entry: 4rb1 (more details), 2.75 Å
SCOPe Domain Sequences for d4rb1b_:
Sequence, based on SEQRES records: (download)
>d4rb1b_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]} hmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtv rlfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhg frlvghrlelygvp
>d4rb1b_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]} hmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdpisiatvyrtvr lfeeesilerhdfgdgraryeeapsehhdhlidvnarvieftspeiealqreiarkhgfr lvghrlelygvp
Timeline for d4rb1b_: