SCOPe 2.05: Domain d4rb1b_: 4rb1 B:

Lineage for d4rb1b_ (4rb1 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries)

8. Domain d4rb1b_: 4rb1 B: [274909]
   automated match to d4etsa_
   protein/DNA complex; complexed with mn

Details for d4rb1b_

PDB Entry: 4rb1, 2.75 Å

PDB Description: crystal structure of magnetospirillum gryphiswaldense msr-1 fur-mn2+- e. coli fur box

PDB Compounds: (B:) DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)

SCOPe Domain Sequences for d4rb1b_:

Sequence, based on SEQRES records:

>d4rb1b_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
hmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtv
rlfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhg
frlvghrlelygvp

Sequence, based on observed residues (ATOM records):

>d4rb1b_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
hmvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdpisiatvyrtvr
lfeeesilerhdfgdgraryeeapsehhdhlidvnarvieftspeiealqreiarkhgfr
lvghrlelygvp

Timeline for d4rb1b_:

• d4rb1b_ is new in SCOPe 2.05-stable
  
• d4rb1b_ is called d4rb1b1 in SCOPe 2.06
  
• d4rb1b_ appears in the current release, SCOPe 2.08, called d4rb1b1