Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries) |
Domain d4rb0a_: 4rb0 A: [274904] automated match to d2w57a_ complexed with flc, so4 |
PDB Entry: 4rb0 (more details), 1.85 Å
SCOPe Domain Sequences for d4rb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rb0a_ a.4.5.0 (A:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]} ghmvsrieqrcidkgmkmtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrt vrlfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkh gfrlvghrlelygvpl
Timeline for d4rb0a_: