SCOPe 2.08: Domain d4razb_: 4raz B:

Lineage for d4razb_ (4raz B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries)

8. Domain d4razb_: 4raz B: [274902]
   automated match to d4etsa_
   complexed with edo, mn

Details for d4razb_

PDB Entry: 4raz, 1.9 Å

PDB Description: crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur

PDB Compounds: (B:) DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)

SCOPe Domain Sequences for d4razb_:

Sequence; same for both SEQRES and ATOM records:

>d4razb_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
mvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvr
lfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgf
rlvghrlelygvpl

Timeline for d4razb_:

• d4razb_ first appeared in SCOPe 2.05
  
• d4razb_ appears in SCOPe 2.07