Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries) |
Domain d4razb_: 4raz B: [274902] automated match to d4etsa_ complexed with edo, mn |
PDB Entry: 4raz (more details), 1.9 Å
SCOPe Domain Sequences for d4razb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4razb_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]} mvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvr lfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgf rlvghrlelygvpl
Timeline for d4razb_: