Lineage for d4qlzb_ (4qlz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790901Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2790902Protein automated matches [190523] (12 species)
    not a true protein
  7. 2790983Species Schistosoma japonicum [TaxId:6182] [274890] (2 PDB entries)
  8. 2790985Domain d4qlzb_: 4qlz B: [274892]
    automated match to d2ik0b_
    complexed with co, po4

Details for d4qlzb_

PDB Entry: 4qlz (more details), 2.33 Å

PDB Description: the structure of inorganic pyrophosphatase from schistosoma japonicum
PDB Compounds: (B:) SJCHGC07024 protein

SCOPe Domain Sequences for d4qlzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlzb_ b.40.5.0 (B:) automated matches {Schistosoma japonicum [TaxId: 6182]}
msvergtsnsasykmflthggspisyfhdvplfadatnncynmiveiprwtnakmeicke
elmnpikhdvknnklryiynvfphkgyiwnygalpqtwedpsyvdedtkakgdndpidvc
eigskiwpsgsvipvkvlgilgmidegetdwkviainvadpmaeklndildvdahmpgfl
katrdwfkyykvpagkpensfafngefknkefaakiiskthehwqklistkveagpiira
nvtvkgspymvskedfidalqkhedfkrgseptdqaieqwhfc

SCOPe Domain Coordinates for d4qlzb_:

Click to download the PDB-style file with coordinates for d4qlzb_.
(The format of our PDB-style files is described here.)

Timeline for d4qlzb_: