Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [274855] (1 PDB entry) |
Domain d5br9c1: 5br9 C:1-108 [274864] Other proteins in same PDB: d5br9a3, d5br9c3 automated match to d3zeua1 |
PDB Entry: 5br9 (more details), 2.35 Å
SCOPe Domain Sequences for d5br9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5br9c1 c.55.1.0 (C:1-108) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} mstllaldtsteacsvallhegralshyeviprlhaqrllpmvrdlldeagvalsavdai afgrgpgaftgvriaigvvqglafalqrpvlavsdlailaqrayreqg
Timeline for d5br9c1: