Lineage for d5br9b1 (5br9 B:1-108)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885495Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [274855] (1 PDB entry)
  8. 2885498Domain d5br9b1: 5br9 B:1-108 [274860]
    Other proteins in same PDB: d5br9a3, d5br9c3
    automated match to d3zeua1

Details for d5br9b1

PDB Entry: 5br9 (more details), 2.35 Å

PDB Description: crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5br9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5br9b1 c.55.1.0 (B:1-108) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mstllaldtsteacsvallhegralshyeviprlhaqrllpmvrdlldeagvalsavdai
afgrgpgaftgvriaigvvqglafalqrpvlavsdlailaqrayreqg

SCOPe Domain Coordinates for d5br9b1:

Click to download the PDB-style file with coordinates for d5br9b1.
(The format of our PDB-style files is described here.)

Timeline for d5br9b1: