SCOP 1.65: Domain d1awtf_: 1awt F:

Lineage for d1awtf_ (1awt F:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (8 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)

8. Domain d1awtf_: 1awt F: [27486]
   mutant

Details for d1awtf_

PDB Entry: 1awt, 2.55 Å

PDB Description: secypa complexed with hagpia

SCOP Domain Sequences for d1awtf_:

Sequence; same for both SEQRES and ATOM records:

>d1awtf_ b.62.1.1 (F:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1awtf_:

• d1awtf_ first appeared (with stable ids) in SCOP 1.55
  
• d1awtf_ appears in SCOP 1.63
  
• d1awtf_ appears in SCOP 1.67
  
• d1awtf_ appears in the current release, SCOPe 2.08