Lineage for d1awtf_ (1awt F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16874Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 16875Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 16876Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (2 proteins)
  6. 16882Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 16888Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)
  8. 16955Domain d1awtf_: 1awt F: [27486]

Details for d1awtf_

PDB Entry: 1awt (more details), 2.55 Å

PDB Description: secypa complexed with hagpia

SCOP Domain Sequences for d1awtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awtf_ b.62.1.1 (F:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1awtf_:

Click to download the PDB-style file with coordinates for d1awtf_.
(The format of our PDB-style files is described here.)

Timeline for d1awtf_: