SCOPe 2.06: Domain d4z5rl2: 4z5r L:107-213

Lineage for d4z5rl2 (4z5r L:107-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4z5rl2: 4z5r L:107-213 [274824]
   Other proteins in same PDB: d4z5ra1, d4z5rd_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj1, d4z5rl1, d4z5rn_, d4z5rp1, d4z5rr1, d4z5rt1, d4z5rv1, d4z5rx_, d4z5ry_
   automated match to d1dn0a2
   complexed with so4

Details for d4z5rl2

PDB Entry: 4z5r, 3 Å

PDB Description: rontalizumab fab bound to interferon-a2

PDB Compounds: (L:) anti-IFN-a antibody rontalizumab light chain

SCOPe Domain Sequences for d4z5rl2:

Sequence; same for both SEQRES and ATOM records:

>d4z5rl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4z5rl2:

• d4z5rl2 first appeared in SCOPe 2.05
  
• d4z5rl2 appears in SCOPe 2.07
  
• d4z5rl2 appears in the current release, SCOPe 2.08