SCOPe 2.05: Domain d4xmll1: 4xml L:1-105

Lineage for d4xmll1 (4xml L:1-105)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4xmll1: 4xml L:1-105 [274811]
   Other proteins in same PDB: d4xmll2
   automated match to d2fjha1

Details for d4xmll1

PDB Entry: 4xml, 2.68 Å

PDB Description: crystal structure of fab of hiv-1 gp120 v3-specific human monoclonal antibody 2424

PDB Compounds: (L:) Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424

SCOPe Domain Sequences for d4xmll1:

Sequence; same for both SEQRES and ATOM records:

>d4xmll1 b.1.1.0 (L:1-105) automated matches {Homo sapiens [TaxId: 9606]}
divmnqsppslavtpgepasiscrasqsllysdghnyldwylqkpgqapqlliylgstra
sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqplqsytfgqgtklei

Timeline for d4xmll1:

• d4xmll1 is new in SCOPe 2.05-stable
  
• d4xmll1 appears in SCOPe 2.06
  
• d4xmll1 appears in the current release, SCOPe 2.08