Lineage for d4urea_ (4ure A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830608Species Aromatoleum aromaticum [TaxId:76114] [274789] (2 PDB entries)
  8. 1830611Domain d4urea_: 4ure A: [274793]
    automated match to d4ni5a_
    complexed with 1ps, act, mg, so4

Details for d4urea_

PDB Entry: 4ure (more details), 1.4 Å

PDB Description: molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1
PDB Compounds: (A:) cyclohexanol dehydrogenase

SCOPe Domain Sequences for d4urea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4urea_ c.2.1.0 (A:) automated matches {Aromatoleum aromaticum [TaxId: 76114]}
mllegktalvtgagngigrtialtyaaeganvvvsdisdewgretlaliegkggkavfqh
adtahpedhdeliaaakrafgrldiacnnagisgeftptaettdaqwqrviginlsgvfy
gvraqiramletgggaivnissiagqigiegitpytaakhgvvgltktvaweygskgiri
nsvgpafinttlvqnvpletrrqleqmhalrrlgeteevanlvawlssdkasfvtgsyya
vdggylar

SCOPe Domain Coordinates for d4urea_:

Click to download the PDB-style file with coordinates for d4urea_.
(The format of our PDB-style files is described here.)

Timeline for d4urea_: