SCOPe 2.05: Domain d4ureb_: 4ure B:

Lineage for d4ureb_ (4ure B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Aromatoleum aromaticum [TaxId:76114] [274789] (2 PDB entries)

8. Domain d4ureb_: 4ure B: [274792]
   automated match to d4ni5a_
   complexed with 1ps, act, mg, so4

Details for d4ureb_

PDB Entry: 4ure, 1.4 Å

PDB Description: molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1

PDB Compounds: (B:) cyclohexanol dehydrogenase

SCOPe Domain Sequences for d4ureb_:

Sequence; same for both SEQRES and ATOM records:

>d4ureb_ c.2.1.0 (B:) automated matches {Aromatoleum aromaticum [TaxId: 76114]}
mllegktalvtgagngigrtialtyaaeganvvvsdisdewgretlaliegkggkavfqh
adtahpedhdeliaaakrafgrldiacnnagisgeftptaettdaqwqrviginlsgvfy
gvraqiramletgggaivnissiagqigiegitpytaakhgvvgltktvaweygskgiri
nsvgpafinttlvqnvpletrrqleqmhalrrlgeteevanlvawlssdkasfvtgsyya
vdggylar

Timeline for d4ureb_:

• d4ureb_ is new in SCOPe 2.05-stable
  
• d4ureb_ appears in SCOPe 2.06
  
• d4ureb_ appears in the current release, SCOPe 2.08