Lineage for d4tvjb2 (4tvj B:365-579)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606598Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2606622Protein automated matches [227023] (1 species)
    not a true protein
  7. 2606623Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries)
  8. 2606631Domain d4tvjb2: 4tvj B:365-579 [274783]
    Other proteins in same PDB: d4tvja1, d4tvja3, d4tvjb1, d4tvjb3
    automated match to d3kjda2
    complexed with 09l, gol

Details for d4tvjb2

PDB Entry: 4tvj (more details), 2.1 Å

PDB Description: human artd2 (parp2) - catalytic domain in complex with olaparib
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4tvjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvjb2 d.166.1.2 (B:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnf

SCOPe Domain Coordinates for d4tvjb2:

Click to download the PDB-style file with coordinates for d4tvjb2.
(The format of our PDB-style files is described here.)

Timeline for d4tvjb2: