SCOPe 2.06: Domain d4tvjb1: 4tvj B:235-364

Lineage for d4tvjb1 (4tvj B:235-364)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (44 PDB entries)

8. Domain d4tvjb1: 4tvj B:235-364 [274782]
   Other proteins in same PDB: d4tvja2, d4tvja3, d4tvjb2, d4tvjb3
   automated match to d3kcza1
   complexed with 09l, gol

Details for d4tvjb1

PDB Entry: 4tvj, 2.1 Å

PDB Description: human artd2 (parp2) - catalytic domain in complex with olaparib

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4tvjb1:

Sequence, based on SEQRES records:

>d4tvjb1 a.41.1.0 (B:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqsp
ehpldqhyrn

Sequence, based on observed residues (ATOM records):

>d4tvjb1 a.41.1.0 (B:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktspehp
ldqhyrn

Timeline for d4tvjb1:

• d4tvjb1 first appeared in SCOPe 2.05
  
• d4tvjb1 appears in SCOPe 2.07
  
• d4tvjb1 appears in the current release, SCOPe 2.08