Class a: All alpha proteins [46456] (289 folds) |
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
Protein automated matches [226964] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225405] (44 PDB entries) |
Domain d4tvjb1: 4tvj B:235-364 [274782] Other proteins in same PDB: d4tvja2, d4tvja3, d4tvjb2, d4tvjb3 automated match to d3kcza1 complexed with 09l, gol |
PDB Entry: 4tvj (more details), 2.1 Å
SCOPe Domain Sequences for d4tvjb1:
Sequence, based on SEQRES records: (download)
>d4tvjb1 a.41.1.0 (B:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqsp ehpldqhyrn
>d4tvjb1 a.41.1.0 (B:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktspehp ldqhyrn
Timeline for d4tvjb1: