SCOPe 2.07: Domain d4tvja2: 4tvj A:365-579

Lineage for d4tvja2 (4tvj A:365-579)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
   automatically mapped to Pfam PF00644

6. Protein automated matches [227023] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries)

8. Domain d4tvja2: 4tvj A:365-579 [274781]
   Other proteins in same PDB: d4tvja1, d4tvja3, d4tvjb1, d4tvjb3
   automated match to d3kjda2
   complexed with 09l, gol

Details for d4tvja2

PDB Entry: 4tvj, 2.1 Å

PDB Description: human artd2 (parp2) - catalytic domain in complex with olaparib

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4tvja2:

Sequence; same for both SEQRES and ATOM records:

>d4tvja2 d.166.1.2 (A:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnf

Timeline for d4tvja2:

• d4tvja2 first appeared in SCOPe 2.05
  
• d4tvja2 appears in SCOPe 2.06
  
• d4tvja2 appears in the current release, SCOPe 2.08