Lineage for d4tscl1 (4tsc L:1-107A)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765023Domain d4tscl1: 4tsc L:1-107A [274760]
    Other proteins in same PDB: d4tsca_, d4tscl2
    automated match to d2mcg11

Details for d4tscl1

PDB Entry: 4tsc (more details), 1.92 Å

PDB Description: structure of a lysozyme antibody complex
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4tscl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tscl1 b.1.1.0 (L:1-107A) automated matches {Homo sapiens [TaxId: 9606]}
qsvltqppsvsgapgqrvsisctgrssnigagydvhwyqqlpgkapklliygntnrpsgv
pvrfsgsmsgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltvlg

SCOPe Domain Coordinates for d4tscl1:

Click to download the PDB-style file with coordinates for d4tscl1.
(The format of our PDB-style files is described here.)

Timeline for d4tscl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tscl2
View in 3D
Domains from other chains:
(mouse over for more information)
d4tsca_