Lineage for d4d6xd_ (4d6x D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838119Species Brucella abortus [TaxId:235] [274729] (2 PDB entries)
  8. 1838125Domain d4d6xd_: 4d6x D: [274734]
    automated match to d1zy2b_
    complexed with imd

Details for d4d6xd_

PDB Entry: 4d6x (more details), 2.11 Å

PDB Description: crystal structure of the receiver domain of ntrx from brucella abortus
PDB Compounds: (D:) bacterial regulatory, fis family protein

SCOPe Domain Sequences for d4d6xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d6xd_ c.23.1.0 (D:) automated matches {Brucella abortus [TaxId: 235]}
dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg
lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralet

SCOPe Domain Coordinates for d4d6xd_:

Click to download the PDB-style file with coordinates for d4d6xd_.
(The format of our PDB-style files is described here.)

Timeline for d4d6xd_: