SCOPe 2.08: Domain d5c92a2: 5c92 A:378-482

Lineage for d5c92a2 (5c92 A:378-482)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Colletotrichum graminicola [TaxId:645133] [274719] (2 PDB entries)

8. Domain d5c92a2: 5c92 A:378-482 [274726]
   Other proteins in same PDB: d5c92a1
   automated match to d1gofa1
   complexed with act, cu1, nag

Details for d5c92a2

PDB Entry: 5c92, 2.1 Å

PDB Description: novel fungal alcohol oxidase with catalytic diversity among the aa5 family, in complex with copper

PDB Compounds: (A:) Kelch domain-containing protein

SCOPe Domain Sequences for d5c92a2:

Sequence; same for both SEQRES and ATOM records:

>d5c92a2 b.1.18.0 (A:378-482) automated matches {Colletotrichum graminicola [TaxId: 645133]}
gvtpakrpviqslsdtavragapititmqdagaytfsmirvsatthtvntdqrripldgq
dggdgksftvnvpndygvaipgyymlfamneagvpcvaqffkvtl

Timeline for d5c92a2:

• d5c92a2 first appeared in SCOPe 2.05
  
• d5c92a2 appears in SCOPe 2.07