Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (43 species) not a true protein |
Species Colletotrichum graminicola [TaxId:645133] [274719] (2 PDB entries) |
Domain d5c86a2: 5c86 A:378-483 [274720] Other proteins in same PDB: d5c86a1 automated match to d1gofa1 |
PDB Entry: 5c86 (more details), 1.51 Å
SCOPe Domain Sequences for d5c86a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c86a2 b.1.18.0 (A:378-483) automated matches {Colletotrichum graminicola [TaxId: 645133]} gvtpakrpviqslsdtavragapititmqdagaytfsmirvsatthtvntdqrripldgq dggdgksftvnvpndygvaipgyymlfamneagvpcvaqffkvtlh
Timeline for d5c86a2: