Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [231176] (3 PDB entries) |
Domain d5c0of_: 5c0o F: [274709] automated match to d2pwya_ complexed with sam, so4; mutant |
PDB Entry: 5c0o (more details), 2.62 Å
SCOPe Domain Sequences for d5c0of_:
Sequence, based on SEQRES records: (download)
>d5c0of_ c.66.1.0 (F:) automated matches {Thermus thermophilus [TaxId: 262724]} plllkdrkgraylvfpkeggvfhhhkgsvphealleagpggvvrthlgeelsvhrptlee yllhmkrsatptapkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesye arphhlaqaernvrafwqvenvrfhlgkleeaeleeaaydgvaldlmepwkvlekaalal kpdrflvaylpnitqvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghtaf lvalrrwk
>d5c0of_ c.66.1.0 (F:) automated matches {Thermus thermophilus [TaxId: 262724]} plllkdrkgraylvfpkeggvfsvphealleagpggvvrthlgeelsvhrptleeyllhm ktptapkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesyearphhlaq aernvrafwqvenvrfhlgkleaaydgvaldlmepwkvlaalalkpdrflvaylpnitqv lelvraaeahpfrlervlevgwrewevrlpvahprfqqvghtaflvalrrwk
Timeline for d5c0of_: