Lineage for d5bo4f_ (5bo4 F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903246Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1903304Protein Elongin C [54699] (3 species)
  7. 1903307Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries)
  8. 1903403Domain d5bo4f_: 5bo4 F: [274692]
    Other proteins in same PDB: d5bo4a1, d5bo4a2, d5bo4b_, d5bo4d1, d5bo4d2, d5bo4e_, d5bo4g1, d5bo4g2, d5bo4h_, d5bo4j1, d5bo4j2, d5bo4k_, d5bo4m1, d5bo4m2, d5bo4p1, d5bo4p2, d5bo4q_
    automated match to d4b9kb_

Details for d5bo4f_

PDB Entry: 5bo4 (more details), 2.9 Å

PDB Description: structure of socs2:elongin c:elongin b from dmso-treated crystals
PDB Compounds: (F:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d5bo4f_:

Sequence, based on SEQRES records: (download)

>d5bo4f_ d.42.1.1 (F:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d5bo4f_ d.42.1.1 (F:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvryeipef
piapeialellmaanfldc

SCOPe Domain Coordinates for d5bo4f_:

Click to download the PDB-style file with coordinates for d5bo4f_.
(The format of our PDB-style files is described here.)

Timeline for d5bo4f_: