Class a: All alpha proteins [46456] (286 folds) |
Fold a.271: SOCS box-like [158234] (1 superfamily) helix-loop-helix motif with orthogonally packed helices |
Superfamily a.271.1: SOCS box-like [158235] (2 families) |
Family a.271.1.1: SOCS box-like [158236] (2 proteins) Pfam PF07525 |
Protein Suppressor of cytokine signaling 2, SOCS-2 [158239] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158240] (2 PDB entries) Uniprot O14508 149-198 |
Domain d5bo4d2: 5bo4 D:149-198 [274688] Other proteins in same PDB: d5bo4a1, d5bo4b_, d5bo4c_, d5bo4d1, d5bo4e_, d5bo4f_, d5bo4g1, d5bo4h_, d5bo4i_, d5bo4j1, d5bo4k_, d5bo4l_, d5bo4m1, d5bo4o_, d5bo4p1, d5bo4q_, d5bo4r_ automated match to d2c9wa1 |
PDB Entry: 5bo4 (more details), 2.9 Å
SCOPe Domain Sequences for d5bo4d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bo4d2 a.271.1.1 (D:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
Timeline for d5bo4d2: