SCOPe 2.05: Domain d4zffb2: 4zff B:107-212

Lineage for d4zffb2 (4zff B:107-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d4zffb2: 4zff B:107-212 [274653]
   Other proteins in same PDB: d4zffb1, d4zffc_, d4zffd_, d4zffl1
   automated match to d1dn0a2
   complexed with so4

Details for d4zffb2

PDB Entry: 4zff, 2.75 Å

PDB Description: dual-acting fab 5a12 in complex with vegf

PDB Compounds: (B:) Fragment antigen binding (Fab) 5A12 Light chain

SCOPe Domain Sequences for d4zffb2:

Sequence, based on SEQRES records:

>d4zffb2 b.1.1.2 (B:107-212) automated matches {Homo sapiens [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Sequence, based on observed residues (ATOM records):

>d4zffb2 b.1.1.2 (B:107-212) automated matches {Homo sapiens [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4zffb2:

• d4zffb2 is new in SCOPe 2.05-stable
  
• d4zffb2 appears in SCOPe 2.06
  
• d4zffb2 appears in the current release, SCOPe 2.08