Lineage for d4zffb1 (4zff B:1-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765137Domain d4zffb1: 4zff B:1-106 [274652]
    Other proteins in same PDB: d4zffb2, d4zffc_, d4zffd_, d4zffl2
    automated match to d1dn0a1
    complexed with so4

Details for d4zffb1

PDB Entry: 4zff (more details), 2.75 Å

PDB Description: dual-acting fab 5a12 in complex with vegf
PDB Compounds: (B:) Fragment antigen binding (Fab) 5A12 Light chain

SCOPe Domain Sequences for d4zffb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zffb1 b.1.1.0 (B:1-106) automated matches {Homo sapiens [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqflssfgvawyqqkpgkapklliygasslysgvp
srfsgsgsgtdftltisslqpedfatyycqqgllspltfgqgtkvei

SCOPe Domain Coordinates for d4zffb1:

Click to download the PDB-style file with coordinates for d4zffb1.
(The format of our PDB-style files is described here.)

Timeline for d4zffb1: