Lineage for d1awrb_ (1awr B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565060Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 565061Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 565062Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 565063Protein Cyclophilin (eukaryotic) [50893] (10 species)
  7. 565076Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (45 PDB entries)
  8. 565141Domain d1awrb_: 1awr B: [27465]

Details for d1awrb_

PDB Entry: 1awr (more details), 1.58 Å

PDB Description: cypa complexed with hagpia

SCOP Domain Sequences for d1awrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awrb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1awrb_:

Click to download the PDB-style file with coordinates for d1awrb_.
(The format of our PDB-style files is described here.)

Timeline for d1awrb_: