![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
![]() | Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57506] (20 PDB entries) Uniprot P15692 40-133 |
![]() | Domain d4zffd_: 4zff D: [274614] Other proteins in same PDB: d4zffb1, d4zffb2, d4zffl1, d4zffl2 automated match to d1katv_ complexed with so4 |
PDB Entry: 4zff (more details), 2.75 Å
SCOPe Domain Sequences for d4zffd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zffd_ g.17.1.1 (D:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
Timeline for d4zffd_: