Lineage for d4zffd_ (4zff D:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260392Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2260404Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2260407Species Human (Homo sapiens) [TaxId:9606] [57506] (20 PDB entries)
    Uniprot P15692 40-133
  8. 2260443Domain d4zffd_: 4zff D: [274614]
    Other proteins in same PDB: d4zffb1, d4zffb2, d4zffl1, d4zffl2
    automated match to d1katv_
    complexed with so4

Details for d4zffd_

PDB Entry: 4zff (more details), 2.75 Å

PDB Description: dual-acting fab 5a12 in complex with vegf
PDB Compounds: (D:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d4zffd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zffd_ g.17.1.1 (D:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd

SCOPe Domain Coordinates for d4zffd_:

Click to download the PDB-style file with coordinates for d4zffd_.
(The format of our PDB-style files is described here.)

Timeline for d4zffd_: