Lineage for d4zffc_ (4zff C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963384Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1963385Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1963386Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1963398Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 1963401Species Human (Homo sapiens) [TaxId:9606] [57506] (17 PDB entries)
    Uniprot P15692 40-133
  8. 1963431Domain d4zffc_: 4zff C: [274613]
    Other proteins in same PDB: d4zffb1, d4zffb2, d4zffl1, d4zffl2
    automated match to d1katv_
    complexed with so4

Details for d4zffc_

PDB Entry: 4zff (more details), 2.75 Å

PDB Description: dual-acting fab 5a12 in complex with vegf
PDB Compounds: (C:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d4zffc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zffc_ g.17.1.1 (C:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d4zffc_:

Click to download the PDB-style file with coordinates for d4zffc_.
(The format of our PDB-style files is described here.)

Timeline for d4zffc_: