Lineage for d4zaka2 (4zak A:186-279)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767332Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)
  8. 1767376Domain d4zaka2: 4zak A:186-279 [274606]
    Other proteins in same PDB: d4zaka1, d4zakb_, d4zakc2
    automated match to d3hujc2
    complexed with 4lx, nag

Details for d4zaka2

PDB Entry: 4zak (more details), 2.82 Å

PDB Description: crystal structure of the mcd1d/db06-1/inktcr ternary complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4zaka2:

Sequence, based on SEQRES records: (download)

>d4zaka2 b.1.1.0 (A:186-279) automated matches {Mus musculus [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d4zaka2 b.1.1.0 (A:186-279) automated matches {Mus musculus [TaxId: 10090]}
qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl
dveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d4zaka2:

Click to download the PDB-style file with coordinates for d4zaka2.
(The format of our PDB-style files is described here.)

Timeline for d4zaka2: