Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Chloroflexus aurantiacus [TaxId:324602] [274582] (3 PDB entries) |
Domain d4z17a1: 4z17 A:1-141 [274600] Other proteins in same PDB: d4z17a2, d4z17b2 automated match to d3qtpa1 complexed with mg, pep |
PDB Entry: 4z17 (more details), 2.65 Å
SCOPe Domain Sequences for d4z17a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z17a1 d.54.1.0 (A:1-141) automated matches {Chloroflexus aurantiacus [TaxId: 324602]} mstlieaivarevldsrgnptievdvrlesgdvgraivpsgastgahealelrdgdksry ngkgvlkavqavnediaealigfdaadqialdqelialdgtpnksklganailgvslaaa kaaaaafglplyrylggvyah
Timeline for d4z17a1: