Lineage for d1cwba_ (1cwb A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16874Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 16875Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 16876Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (2 proteins)
  6. 16882Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 16888Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)
  8. 16928Domain d1cwba_: 1cwb A: [27459]

Details for d1cwba_

PDB Entry: 1cwb (more details), 2.2 Å

PDB Description: the x-ray structure of (mebm2t)1-cyclosporin complexed with cyclophilin a provides an explanation for its anomalously high immunosuppressive activity

SCOP Domain Sequences for d1cwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwba_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1cwba_:

Click to download the PDB-style file with coordinates for d1cwba_.
(The format of our PDB-style files is described here.)

Timeline for d1cwba_: