Lineage for d4ywsa1 (4yws A:2-141)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905379Species Chloroflexus aurantiacus [TaxId:324602] [274582] (3 PDB entries)
  8. 1905380Domain d4ywsa1: 4yws A:2-141 [274583]
    Other proteins in same PDB: d4ywsa2, d4ywsb2
    automated match to d3qtpa1
    complexed with mg

Details for d4ywsa1

PDB Entry: 4yws (more details), 2.45 Å

PDB Description: thermostable enolase from chloroflexus aurantiacus
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d4ywsa1:

Sequence, based on SEQRES records: (download)

>d4ywsa1 d.54.1.0 (A:2-141) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
stlieaivarevldsrgnptievdvrlesgdvgraivpsgastgahealelrdgdksryn
gkgvlkavqavnediaealigfdaadqialdqelialdgtpnksklganailgvslaaak
aaaaafglplyrylggvyah

Sequence, based on observed residues (ATOM records): (download)

>d4ywsa1 d.54.1.0 (A:2-141) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
stlieaivarevldsrgnptievdvrlesgdvgraivpsgstgahealelrdgdksryng
kgvlkavqavnediaealigfdaadqialdqelialdgtpnksklganailgvslaaaka
aaaafglplyrylggvyah

SCOPe Domain Coordinates for d4ywsa1:

Click to download the PDB-style file with coordinates for d4ywsa1.
(The format of our PDB-style files is described here.)

Timeline for d4ywsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ywsa2