Lineage for d4yhac_ (4yha C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1805718Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1805719Protein automated matches [191011] (12 species)
    not a true protein
  7. 1805751Species Helicobacter pylori [TaxId:85962] [274562] (2 PDB entries)
  8. 1805762Domain d4yhac_: 4yha C: [274573]
    automated match to d1koqa_
    complexed with cl, gol, mzm, zn

Details for d4yhac_

PDB Entry: 4yha (more details), 2.2 Å

PDB Description: crystal structure of the complex of helicobacter pylori alpha-carbonic anhydrase with methazolamide
PDB Compounds: (C:) Alpha-carbonic anhydrase

SCOPe Domain Sequences for d4yhac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yhac_ b.74.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkav
ffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrll
vlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegva
wfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr

SCOPe Domain Coordinates for d4yhac_:

Click to download the PDB-style file with coordinates for d4yhac_.
(The format of our PDB-style files is described here.)

Timeline for d4yhac_: