Lineage for d4ygff_ (4ygf F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1805718Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1805719Protein automated matches [191011] (12 species)
    not a true protein
  7. 1805751Species Helicobacter pylori [TaxId:85962] [274562] (2 PDB entries)
  8. 1805757Domain d4ygff_: 4ygf F: [274566]
    automated match to d1koqa_
    complexed with azm, cl, gol, zn

Details for d4ygff_

PDB Entry: 4ygf (more details), 2 Å

PDB Description: crystal structure of the complex of helicobacter pylori alpha-carbonic anhydrase with acetazolamide
PDB Compounds: (F:) Alpha-carbonic anhydrase

SCOPe Domain Sequences for d4ygff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ygff_ b.74.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
wdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavff
thhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvl
aigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvawf
vieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr

SCOPe Domain Coordinates for d4ygff_:

Click to download the PDB-style file with coordinates for d4ygff_.
(The format of our PDB-style files is described here.)

Timeline for d4ygff_: