SCOPe 2.05: Domain d4rwyl2: 4rwy L:108-214

Lineage for d4rwyl2 (4rwy L:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d4rwyl2: 4rwy L:108-214 [274510]
   Other proteins in same PDB: d4rwyl1
   automated match to d1n0xl2
   complexed with edo, epe, na, nag

Details for d4rwyl2

PDB Entry: 4rwy, 2.13 Å

PDB Description: crystal structure of vh1-46 germline-derived cd4-binding site-directed antibody 8anc131 in complex with hiv-1 clade b yu2 gp120

PDB Compounds: (L:) Antibody 8ANC131 Light chain

SCOPe Domain Sequences for d4rwyl2:

Sequence; same for both SEQRES and ATOM records:

>d4rwyl2 b.1.1.2 (L:108-214) automated matches {Homo sapiens [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

Timeline for d4rwyl2:

• d4rwyl2 is new in SCOPe 2.05-stable
  
• d4rwyl2 appears in SCOPe 2.06
  
• d4rwyl2 appears in the current release, SCOPe 2.08