Lineage for d5bxqe_ (5bxq E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124942Protein Ran [52609] (2 species)
  7. 2124943Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries)
    Uniprot P62825
  8. 2124970Domain d5bxqe_: 5bxq E: [274454]
    Other proteins in same PDB: d5bxqa_, d5bxqb_
    automated match to d1a2ke_
    complexed with gdp, mg, so4

Details for d5bxqe_

PDB Entry: 5bxq (more details), 2.5 Å

PDB Description: structure of the ntf2:rangdp complex
PDB Compounds: (E:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5bxqe_:

Sequence, based on SEQRES records: (download)

>d5bxqe_ c.37.1.8 (E:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpde

Sequence, based on observed residues (ATOM records): (download)

>d5bxqe_ c.37.1.8 (E:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrnlqyydisaksnynfekpflwlarkligdpnlefvampalappevvm
dpalaaqyehdlevaqttalpde

SCOPe Domain Coordinates for d5bxqe_:

Click to download the PDB-style file with coordinates for d5bxqe_.
(The format of our PDB-style files is described here.)

Timeline for d5bxqe_: