SCOPe 2.05: Domain d1cwoa_: 1cwo A:

Lineage for d1cwoa_ (1cwo A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (78 PDB entries)
   Uniprot P05092

8. Domain d1cwoa_: 1cwo A: [27445]

Details for d1cwoa_

PDB Entry: 1cwo, 1.86 Å

PDB Description: human cyclophilin a complexed with thr2, leu5, d-hiv8, leu10 cyclosporin

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1cwoa_:

Sequence; same for both SEQRES and ATOM records:

>d1cwoa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1cwoa_:

• d1cwoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwoa_ appears in SCOPe 2.04
  
• d1cwoa_ appears in SCOPe 2.06
  
• d1cwoa_ appears in the current release, SCOPe 2.08