Lineage for d2rmao_ (2rma O:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301509Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 301510Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 301511Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 301517Protein Cyclophilin (eukaryotic) [50893] (8 species)
  7. 301526Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 301565Domain d2rmao_: 2rma O: [27442]

Details for d2rmao_

PDB Entry: 2rma (more details), 2.1 Å

PDB Description: crystal structures of cyclophilin a complexed with cyclosporin a and n-methyl-4-[(e)-2-butenyl]-4,4-dimethylthreonine cyclosporin a

SCOP Domain Sequences for d2rmao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmao_ b.62.1.1 (O:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d2rmao_:

Click to download the PDB-style file with coordinates for d2rmao_.
(The format of our PDB-style files is described here.)

Timeline for d2rmao_: