Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Pf GST [101210] (1 species) cannot be assigned to any of the known GST classes |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries) |
Domain d4zxgb2: 4zxg B:86-207 [274403] Other proteins in same PDB: d4zxga1, d4zxgb1 automated match to d1okta1 complexed with gol, mes, so4 |
PDB Entry: 4zxg (more details), 1.7 Å
SCOPe Domain Sequences for d4zxgb2:
Sequence, based on SEQRES records: (download)
>d4zxgb2 a.45.1.1 (B:86-207) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn rk
>d4zxgb2 a.45.1.1 (B:86-207) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkkndky yfvgnnltyadlavfnlyddietkylknfpllkahnefisnlpniknyitnrk
Timeline for d4zxgb2: