SCOPe 2.05: Domain d4z95l2: 4z95 L:108-214

Lineage for d4z95l2 (4z95 L:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)

8. Domain d4z95l2: 4z95 L:108-214 [274401]
   Other proteins in same PDB: d4z95l1
   automated match to d2v7ha2
   protein/DNA complex; complexed with po4

Details for d4z95l2

PDB Entry: 4z95, 1.79 Å

PDB Description: fab structure of antibody s1-15 in complex with ssdna dna, 5'-5(dt)-p- 3'

PDB Compounds: (L:) S1-15 Fab (IgG2b) light chain

SCOPe Domain Sequences for d4z95l2:

Sequence; same for both SEQRES and ATOM records:

>d4z95l2 b.1.1.2 (L:108-214) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4z95l2:

• d4z95l2 is new in SCOPe 2.05-stable
  
• d4z95l2 appears in SCOPe 2.06
  
• d4z95l2 appears in the current release, SCOPe 2.08