Lineage for d4z95l1 (4z95 L:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767332Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)
  8. 1767333Domain d4z95l1: 4z95 L:1-107 [274400]
    Other proteins in same PDB: d4z95l2
    automated match to d2v7ha1
    protein/DNA complex; complexed with po4

Details for d4z95l1

PDB Entry: 4z95 (more details), 1.79 Å

PDB Description: fab structure of antibody s1-15 in complex with ssdna dna, 5'-5(dt)-p- 3'
PDB Compounds: (L:) S1-15 Fab (IgG2b) light chain

SCOPe Domain Sequences for d4z95l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z95l1 b.1.1.0 (L:1-107) automated matches {Mus musculus [TaxId: 10090]}
diqmtqstsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvkvliyytsrlrsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik

SCOPe Domain Coordinates for d4z95l1:

Click to download the PDB-style file with coordinates for d4z95l1.
(The format of our PDB-style files is described here.)

Timeline for d4z95l1: