![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Mus musculus [TaxId:10090] [272437] (43 PDB entries) |
![]() | Domain d4z95l1: 4z95 L:1-107 [274400] Other proteins in same PDB: d4z95l2 automated match to d2v7ha1 protein/DNA complex; complexed with po4 |
PDB Entry: 4z95 (more details), 1.79 Å
SCOPe Domain Sequences for d4z95l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z95l1 b.1.1.0 (L:1-107) automated matches {Mus musculus [TaxId: 10090]} diqmtqstsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvkvliyytsrlrsgvps rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik
Timeline for d4z95l1: