Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4z78d2: 4z78 D:182-275 [274389] Other proteins in same PDB: d4z78a1, d4z78a3, d4z78b1, d4z78b2, d4z78d1, d4z78d3, d4z78e1, d4z78e2, d4z78g1, d4z78g3, d4z78h1, d4z78h2 automated match to d1fo0h1 complexed with edo, gol, so4 |
PDB Entry: 4z78 (more details), 2.3 Å
SCOPe Domain Sequences for d4z78d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z78d2 b.1.1.0 (D:182-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf qkwaavvvplgkeqnytchvhhkglpepltlrwk
Timeline for d4z78d2: