SCOPe 2.05: Domain d4z78a2: 4z78 A:182-276

Lineage for d4z78a2 (4z78 A:182-276)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d4z78a2: 4z78 A:182-276 [274387]
   Other proteins in same PDB: d4z78a1, d4z78b_, d4z78d1, d4z78e_, d4z78g1, d4z78h_
   automated match to d1fo0h1
   complexed with edo, gol, so4

Details for d4z78a2

PDB Entry: 4z78, 2.3 Å

PDB Description: weak tcr binding to an unstable insulin epitope drives type 1 diabetes

PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d4z78a2:

Sequence; same for both SEQRES and ATOM records:

>d4z78a2 b.1.1.0 (A:182-276) automated matches {Mus musculus [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrwkp

Timeline for d4z78a2:

• d4z78a2 is new in SCOPe 2.05-stable
  
• d4z78a2 appears in SCOPe 2.06
  
• d4z78a2 appears in the current release, SCOPe 2.08