Lineage for d4z78g2 (4z78 G:182-275)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035074Domain d4z78g2: 4z78 G:182-275 [274385]
    Other proteins in same PDB: d4z78a1, d4z78a3, d4z78b1, d4z78b2, d4z78d1, d4z78d3, d4z78e1, d4z78e2, d4z78g1, d4z78g3, d4z78h1, d4z78h2
    automated match to d1fo0h1
    complexed with edo, gol, so4

Details for d4z78g2

PDB Entry: 4z78 (more details), 2.3 Å

PDB Description: weak tcr binding to an unstable insulin epitope drives type 1 diabetes
PDB Compounds: (G:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d4z78g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z78g2 b.1.1.0 (G:182-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrwk

SCOPe Domain Coordinates for d4z78g2:

Click to download the PDB-style file with coordinates for d4z78g2.
(The format of our PDB-style files is described here.)

Timeline for d4z78g2: