Lineage for d4yefd_ (4yef D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771012Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 1771047Protein automated matches [190844] (1 species)
    not a true protein
  7. 1771048Species Norway rat (Rattus norvegicus) [TaxId:10116] [188163] (3 PDB entries)
  8. 1771056Domain d4yefd_: 4yef D: [274369]
    automated match to d1z0mb_
    complexed with 4cq, glu, gol, so4

Details for d4yefd_

PDB Entry: 4yef (more details), 1.72 Å

PDB Description: beta1 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclododextrin
PDB Compounds: (D:) 5'-AMP-activated protein kinase subunit beta-1

SCOPe Domain Sequences for d4yefd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yefd_ b.1.18.21 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptvfrwtgggkevylsgsfnnwsklpltrsqnnfvaildlpegehqykffvdgqwthdps
epivtsqlgtvnniiqv

SCOPe Domain Coordinates for d4yefd_:

Click to download the PDB-style file with coordinates for d4yefd_.
(The format of our PDB-style files is described here.)

Timeline for d4yefd_: