Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (16 species) |
Species Escherichia coli K-12 [TaxId:83333] [311109] (3 PDB entries) |
Domain d4x43c_: 4x43 C: [274350] automated match to d4hu9a_ |
PDB Entry: 4x43 (more details), 1.65 Å
SCOPe Domain Sequences for d4x43c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x43c_ c.47.1.1 (C:) Thioredoxin {Escherichia coli K-12 [TaxId: 83333]} dkiihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklnid qnagtaakygirgiatlllfkngevaatkvgalskgqlkefldanla
Timeline for d4x43c_: