Lineage for d4wcob_ (4wco B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235465Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2235685Domain d4wcob_: 4wco B: [274338]
    automated match to d1hyrb_
    complexed with act, so4, zn

Details for d4wcob_

PDB Entry: 4wco (more details), 2.46 Å

PDB Description: crystal structure of extracellular domain of human lectin-like transcript 1 (llt1), the ligand for natural killer receptor-p1a
PDB Compounds: (B:) C-type lectin domain family 2 member D

SCOPe Domain Sequences for d4wcob_:

Sequence, based on SEQRES records: (download)

>d4wcob_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsd
hwiglsreqgqpwkwingtewtrqfpilgagecaylndkgassarcyterkwicsksd

Sequence, based on observed residues (ATOM records): (download)

>d4wcob_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqaacpeswigfqrkcfyfsddtknwtssqrfcdsqdadlaqvesfqelnfllrykgpsd
hwiglsreqpwkwinwtrqfpilgagecaylndkgassarcyterkwicsksd

SCOPe Domain Coordinates for d4wcob_:

Click to download the PDB-style file with coordinates for d4wcob_.
(The format of our PDB-style files is described here.)

Timeline for d4wcob_: